DPCstruct | MC51697
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 163 ± 10 aa |
| Standard deviation of domain lengths | 9.85 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 67.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 31.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V1BVA2 | 9-156 | PHFTATGQPMSTYKPSAWANACLWGEQAPNHPPFKFTDQSLIPVIVRVARSEKDMSTSRPPRRTSRLSSLIEGFQTSRAKSSNIKVV… |
| A0A1B8FUX7 | 1-174 | MVRSHPILERKHSTSSSGSSNSTPSDTDCFERFTAAGRPMPTDYRSAWSSACMFGPTAPHFLPFRFTDDSIIPVVVRVCEESFKAGV… |
| A0A093YEN6 | 258-415 | None |
| U1GC85 | 36-205 | None |
| A0A1E1M989 | 50-226 | None |
| A0A6A6F5K0 | 35-196 | None |
| A0A5N6KJT9 | 36-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.