DPCstruct | MC51691
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 150 ± 11 aa |
| Standard deviation of domain lengths | 11.41 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0111 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z0A9S0 | 1-158 | MSSLGATAFVIFSVVSIVTLKELNMQVTEPYMDEPFHIPQVQEYCQENWTYWDPKITTPPGLYVLTIILKNIFMFKCKLPTLRLTPL… |
| A0A2V1BFE7 | 1-183 | MLDTPFSPLQLLKSFQVSVLVAYVALYALTKFWLSHVTKAVREPYLDENFHIPQAQAYCKGRYDVWDPKLTTPSGLYILSTLYAKLS… |
| A0A816T6D7 | 7-158 | None |
| A0A0E9NLY6 | 4-141 | None |
| B6K2W5 | 1-153 | None |
| A0A5N6JTT4 | 392-542 | None |
| A0A7J7C5G4 | 2-144 | None |
| A0A7R9GVL0 | 6-152 | None |
| A0A1Q2YD54 | 1-131 | None |
| A7F8P0 | 436-587 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.