DPCstruct | MC5169
Metacluster Properties and Pfam Annotations
| Number of structural domains | 193 |
|---|---|
| Mean domain length (aa) | 165 ± 26 aa |
| Standard deviation of domain lengths | 25.52 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 17.91 |
| Pfam Score | 93.28 |
| Assigned Pfam label(s) | CL0063- CL0423- CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A562ZLV1 | 3-142 | RRPRLVQAFAQLNAAVMDPAGEVDLGFRRLIGHVASKAAGCLYCQAHTLLGAANFGVSEEKLAAVWNYATSPLYDQRERVALDFALA… |
| A0A379BMD6 | 5-176 | PYGDLDALSPEVRAQVKLFGDSNIDRMLAHADAVVGPVLETRFVMLAESALDPRLREMVILLIAHHCHCAYEAAQHEGLVQKVGLTQ… |
| A0A542N2T2 | 4-186 | None |
| A0A1V8SK96 | 2-181 | None |
| A0A2E1CVS1 | 10-170 | None |
| A0A7I9WSB9 | 2-129 | None |
| A0A1B7Y691 | 177-361 | None |
| A0A8B4RAJ7 | 305-486 | None |
| W5W8J2 | 5-141 | None |
| H0EGD8 | 1-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.