DPCstruct | MC51688
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 258 ± 40 aa |
| Standard deviation of domain lengths | 39.58 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 70.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 15.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V1B3X2 | 12-259 | LFVPPVEPSASSNKPNGTPLVDLTEPDGKSKPLNTGELSDDEALFTPAQAREATGQSHGGKIVAWREQDRPKPVIVRYGPQNAAKYE… |
| A0A5N7BYU0 | 475-682 | DGTLPDVPQYAESEADYSDITDLDDLEEEARNAADFSGGEVLYWWKRGVGSQAFVRYGKGRSATYRVRAGANVDYDPSSVPQVLASG… |
| A0A4Q7KDE5 | 2-260 | None |
| L2GAG7 | 13-290 | None |
| A0A2H3TZL5 | 631-865 | None |
| A0A6A5SIJ0 | 2-272 | None |
| A0A438N3V3 | 753-978 | None |
| A0A7R7WBE9 | 135-393 | None |
| A0A5M9LAV0 | 149-443 | None |
| A0A1L9U3S4 | 150-542 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.