DPCstruct | MC51687
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 246 ± 37 aa |
| Standard deviation of domain lengths | 36.52 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.83 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0229- CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L9WJF1 | 9-218 | HADEPAAHQGWGPLITDSKQPTPLFTRLLDAIFIYFTNTPPVDSRGFDPVKYASVFTALFYSDNNNLSRRYYMFASENHMPAPEQFA… |
| A0A2V1B3F5 | 12-228 | KPAADAYLDITPTFNDDLELSTVDKKWGCLFYGNTPTDRFGQLNRGIANHINELDTPYKTIVIPPRKMVEFYSRFELQDENYPLKTI… |
| A0A545WC23 | 178-475 | None |
| A0A0J9WDM1 | 4-261 | None |
| A0A1V6TSZ9 | 21-263 | None |
| A0A1L9TZF8 | 2-224 | None |
| A0A2H3C4V5 | 81-372 | None |
| A0A146FML6 | 2-289 | None |
| A0A2T6ZVT8 | 8-263 | None |
| A0A5N5Q2G4 | 2-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.