DPCstruct | MC51685
Metacluster Properties and Pfam Annotations
| Number of structural domains | 133 |
|---|---|
| Mean domain length (aa) | 135 ± 24 aa |
| Standard deviation of domain lengths | 23.78 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0629 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A154PF10 | 4-131 | IFPGTKWCGSGNVATGPEDLGKYMETDACCREHDMCNDVIEARQTKHGLTNPAFYTRLQCACDEKFFDCLRRSEDGAGSSVGFFYFN… |
| A0A182J6W9 | 95-235 | RLQIELSQKARRQRRDLSDMLRVPGTKWCGKGWSARNYVEMGGYSKADRCCRQHDLSCPFWILGFETKYSMFNWRVNTLMHCSCDER… |
| A0A4W4E5R3 | 83-222 | None |
| A0A7R9A9S1 | 98-246 | None |
| A0A482VAS0 | 6-118 | None |
| A0A482VZE2 | 2-92 | None |
| H9GK47 | 23-175 | None |
| A0A813RH39 | 2-87 | None |
| H3A0T4 | 70-244 | None |
| T1L4C9 | 95-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.