DPCstruct | MC5168
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 179 ± 21 aa |
| Standard deviation of domain lengths | 20.54 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 24.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7L5AJ81 | 42-184 | TAEGRIETLQSNSASLERDLDEMTQARNVFKNASDDVAALEESVAERELAVTGREEAITAKETRIQATTLKDGTYYTVGVSMEAGTY… |
| A0A4Y3ND47 | 9-189 | VPDVTYTSLTEVWASTEYVRLASCTASYEGPGPFEPTEDEAKIISIAEPGISPSDGLETYLTALALCTRVSDEAASGLFGRNSRQML… |
| A0A3S3A687 | 4-146 | None |
| A0A7K1UIS5 | 127-292 | None |
| A0A229W155 | 367-570 | None |
| A0A3N2JZ47 | 4-165 | None |
| A0A251YDH5 | 112-302 | None |
| A0A4R8WH27 | 190-369 | None |
| A0A2S5V6A4 | 214-404 | None |
| A0A428XAU3 | 71-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.