DPCstruct | MC51679
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 120 ± 18 aa |
| Standard deviation of domain lengths | 18.34 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R4U124 | 1-124 | MSSVNRWEAVLGVILGLLVNEITDISPWIARRLVRWSAYRWTTDPEIAAGYAEEWEALIDDRPGKLFKLLTAVRFSLGAAGRAAPQL… |
| A0A100Y1B8 | 1-88 | MDALISLGWLGIGLLLNEAVDISPWLARRILRWAAHRLPDIDEAREYEEEWTALLDERPGKLLKLVYALTFILPALQMRRASLGHLSW |
| A0A328P157 | 2-92 | None |
| B4V1R1 | 10-138 | None |
| A0A4D4KJL5 | 2-105 | None |
| K0K091 | 1-128 | None |
| A0A428WIK5 | 389-528 | None |
| A0A4V3KYF5 | 1-112 | None |
| A0A2W2CFZ6 | 1-148 | None |
| A0A4R7PML3 | 1-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.