DPCstruct | MC51678
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 284 ± 58 aa |
| Standard deviation of domain lengths | 57.51 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 71.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.82 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06991 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0V6N7 | 5-192 | KTAAEAEEARKREEEAEEQRKLDSKELAGESIRRELAEKEAAEIVPEVDDTDGLDVEAEFEEWRTRELARLLREKQAQAAKDEEKEE… |
| Q9P7H6 | 86-355 | SEYETDASSAEGGSNSAASSSEEEDSSDSEYEMELRRRTLLLPPKFTSKVIKNRAKANEEDTEVLKKVTSQKILEETIKRELLLKET… |
| F4Q8R6 | 158-460 | None |
| A0A7D8V2M0 | 1-367 | None |
| A0A074RLE3 | 14-259 | None |
| N1QQS3 | 351-618 | None |
| L8GQA3 | 223-486 | None |
| A0A3P7AKR4 | 45-342 | None |
| A0A7R7VQ19 | 142-416 | None |
| A0A1Y2G9H4 | 41-473 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.