DPCstruct | MC51675
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 192 ± 46 aa |
| Standard deviation of domain lengths | 45.94 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 75.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 40.17 |
| Pfam Score | 98.21 |
| Assigned Pfam label(s) | PF06246- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| O74370 | 13-214 | TEKRPKDIKSIKSVPICEKHRASVVKDISRKISRIQSATLPEYQIRDLNDAINRLMREKHEWEVQIRDLGGINYLYNKAKLFEDEGE… |
| E2L9R1 | 2-152 | ASACKSLRECERWRGEILREISRKVSKIQDAGLTDYEVRDLNDEINKLVREKRHWENQIVALGGANYRRNVAMLDDDGKEVPGTKGY… |
| A0A2G3B6P0 | 2-139 | None |
| A0A7N4NPS5 | 5-138 | None |
| A0A4V6A4A9 | 1-241 | None |
| A0A6A5DPR1 | 2-241 | None |
| H2B0A9 | 1-212 | None |
| A0A7S3N955 | 2-120 | None |
| A0A803JIR3 | 9-138 | None |
| A0A177WJM4 | 754-980 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.