DPCstruct | MC51671
Metacluster Properties and Pfam Annotations
| Number of structural domains | 175 |
|---|---|
| Mean domain length (aa) | 148 ± 28 aa |
| Standard deviation of domain lengths | 27.69 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.44 |
| Pfam Score | 90.08 |
| Assigned Pfam label(s) | CL0063- CL0020- PF00557- PF03469- CL0603 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V4NIZ4 | 96-271 | IFKYLGGVDAIPVVLNVKEPDKIVEVVKAISSSFGGINLEDIEQPKCFYVLEKLKEELDIPVWHDDQQGTATVTLAGLINALKIVDK… |
| A0A5A7RJM6 | 259-400 | GLQEHRLDGEEYLAVIDEFMEAVFTRWPHVIVQFEDFQSKWAFKLLQRYRNNYRMFNDDVQGTAGVALAGLLGAVRAQGRPMIDFPK… |
| A0A377D227 | 40-155 | None |
| B5IJQ0 | 469-632 | None |
| E6LNL3 | 283-449 | None |
| A0A484X864 | 32-146 | None |
| J4KU55 | 22-167 | None |
| A0A6D2HEF4 | 621-789 | None |
| A0A0B8NJ84 | 55-219 | None |
| A0A661NPT9 | 97-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.