DPCstruct | MC5167
Metacluster Properties and Pfam Annotations
| Number of structural domains | 687 |
|---|---|
| Mean domain length (aa) | 112 ± 17 aa |
| Standard deviation of domain lengths | 17.00 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.97 |
| Pfam Score | 84.79 |
| Assigned Pfam label(s) | CL0418- PF11149- CL0113- CL0110- PF01062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6XL78 | 70-172 | TAQRDRRQNLPAAIYSITNTINGMGYIGQSTQWPRRWTSHKRNLRKNTHVNKHLQQDYNKYGKDAFVFAVLEEYPADTSPELLLERE… |
| A0A1L8H3J1 | 1-104 | MYHTCMSTNVIYLLKCPCGSAYVGKTNRMVRVRLNEHRSAIRNVKAKPTSVSRHWAEYNHTISQLRWMVLEEVVLKSGNVDQKPLQR… |
| A0A2B4SBS9 | 540-641 | None |
| A0A7M3RQA8 | 64-185 | None |
| A0A2B4SFH9 | 364-473 | None |
| A0A2B4SKY1 | 994-1107 | None |
| A0A7M3RJW8 | 149-260 | None |
| A0A7M3RP22 | 159-275 | None |
| A0A7M3RP97 | 1-119 | None |
| A0A7M3RRA0 | 4-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.