DPCstruct | MC51667
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 86 ± 7 aa |
| Standard deviation of domain lengths | 6.90 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 22.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L0EVP7 | 18-109 | HLEKKLVLVEWEDSCQPISDWVLFSEKMGIDVAEVKSVGWLLKYTERTVVLVPNVGNSKKDNAQGSGVIHIPMSAVIKVSAIADKEA… |
| A0A2E5E9I5 | 66-153 | TDVQWEMVSVFWIDAESDGGSGWQDPEDMLEYARRPLPVMHTVGLLVYEDAEQIAITDTKGPEEMGSITKIPRIWLKRFDRLGPVSSK |
| A0A7Z9QME9 | 3-84 | None |
| A0A2D9CH21 | 16-88 | None |
| A0A497MK80 | 8-112 | None |
| A0A0F9EXQ2 | 2-81 | None |
| A0A0F9E7Y0 | 1-78 | None |
| A0A849TQH3 | 10-94 | None |
| A0A2D5ABF4 | 2-87 | None |
| A0A3M1LG77 | 2-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.