DPCstruct | MC51665
Metacluster Properties and Pfam Annotations
| Number of structural domains | 106 |
|---|---|
| Mean domain length (aa) | 301 ± 72 aa |
| Standard deviation of domain lengths | 72.20 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 83.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.71 |
| Pfam Score | 97.35 |
| Assigned Pfam label(s) | CL0707- PF03595- CL0129- PF21057- CL0399 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U0QJ44 | 31-355 | GTGIIAVGAASLPVDLPGRDSIARAFWVLATAALLLLSVAFAAHWVRHREQALGYARNPAMAPFYGALPMAVLTVGAGTAAVGTEIF… |
| A0A1H2QSH1 | 17-279 | ILIFVLLCIMYTIKLVKYPKVVLSEFSNPIAGNFFGAVTVAILLLSAFISSYSQILGQSLWIIGTCLTLLLSYFLVSRLFKAKQDLL… |
| A0A0D3BVM0 | 478-643 | None |
| A0A1R7T388 | 207-501 | None |
| A0A5C3MHM7 | 17-271 | None |
| A0A523CTY2 | 322-704 | None |
| A0A3P6CKK8 | 316-486 | None |
| A0A146FIP5 | 2-213 | None |
| A0A146HAM2 | 25-365 | None |
| A0A3N4KQ71 | 1-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.