DPCstruct | MC5166
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 113 ± 12 aa |
| Standard deviation of domain lengths | 11.70 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14886 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A671XQU3 | 44-164 | KMEPSVVHQNAIHVETIRKEQRQQKLHTEFSINPHRKLHILPDKPMSRKPPEVLADSDFIKAFHKARQEPTKKYEMPQTESQEIGWL… |
| A0A1L8GM48 | 7-128 | KEQRDEVSLNAIHRETIKKENRCQKLVTEFGINPYRKVHAIARKPMSWDDNENETADDHFLKIIHHGALEPTKKYTEPQTTSQEIGW… |
| A0A2I0UKA2 | 8-119 | None |
| U3INF8 | 460-573 | None |
| A0A507FP60 | 15-127 | None |
| A0A3Q0E2G2 | 73-202 | None |
| A0A3B3D8Z3 | 50-171 | None |
| F1PYF0 | 179-306 | None |
| A0A3Q0RVR2 | 25-136 | None |
| A0A7J5XEH7 | 3-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.