DPCstruct | MC51656
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 143 ± 9 aa |
| Standard deviation of domain lengths | 8.92 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 32.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21074 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A7L123 | 5-147 | LLGDMKIWAFSELLETTWIDTDRGHPLLERYFPQRLRDSVRTYFPKHPLKREIVATMAANHVVNHAGIAFLPRVATATGAEVGHIVA… |
| A0A850DK23 | 134-275 | LMAHVKLSLKAELLAGDLPDNPSFASRLPNYFPTPLRERFAGTIKTHPLRREIVATMLANEMVDFGGITYAFRLAEEAGASTADAVR… |
| A0A7C8DPU6 | 62-199 | None |
| A0A1I7Y4X7 | 199-336 | None |
| A0A7K1JNE5 | 189-345 | None |
| A0A3S4IHZ9 | 2-145 | None |
| A0A534BXF7 | 103-248 | None |
| A0A6G3UZA0 | 109-235 | None |
| A0A7V0RKR7 | 388-522 | None |
| A0A7Y2TR21 | 2-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.