DPCstruct | MC51653
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 104 ± 13 aa |
| Standard deviation of domain lengths | 12.73 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F8PPN2 | 1-95 | MTVFVLLAMMPAEPRKLLNEMLPNDTRAWKTWKDTVLDKIEKNQELRFSENHWNIAGFRDDETSLLKTLYGDAEDAYEGHLGHRASR… |
| A0A0C3PUA6 | 32-136 | TKYTFGTRTSGVVFALLLLQTEKAEKVMNELLPTPNTKAWRRWKTIILDRIRWRGDFDFDTSEWDDGTWSKTEKAMLVGLFQDARDA… |
| A0A1C7MF46 | 2-109 | None |
| A0A1C7MEM8 | 323-413 | None |
| F8NPM4 | 264-366 | None |
| A0A0C9Y7J8 | 497-587 | None |
| A0A4Q9MC81 | 39-174 | None |
| A0A060S886 | 21-139 | None |
| A0A0D0DS29 | 80-176 | None |
| A0A0C9ZLB8 | 135-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.