DPCstruct | MC51652
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 111 ± 9 aa |
| Standard deviation of domain lengths | 8.74 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3PU68 | 1-124 | MSASARRLGEETDRAYAIQVAAGTKSAAVYGVLGWGAVTIAHYTWPFFRHQTLAFKSFLVSTSMVFGLAIGADSALLSHEAERRRSE… |
| A0A2A9NWV8 | 18-116 | QARAATEGAAQAMAAGLGLTILGHYTWPLFRRQTLAFKAFLVSACAIAGLTFGAENALLAHEAQRRREENLMRREARLDLARQGLVG… |
| F0X8U2 | 317-421 | None |
| A0A3N2PXJ9 | 88-194 | None |
| A0A6G1G689 | 1-107 | None |
| A0A1C7MMI9 | 680-787 | None |
| J3PGI1 | 38-143 | None |
| K5W6U6 | 2-100 | None |
| A0A0F7SKK9 | 3-116 | None |
| A0A167TCA6 | 23-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.