DPCstruct | MC5165
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 114 ± 18 aa |
| Standard deviation of domain lengths | 17.92 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 73.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 34.30 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0220- PF20743 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W3KIA7 | 10-120 | VDNPSRGGKVLKIPGKIRRLESESMMEQDKESKLQEKNWIDRFTRLERALHLLDNRTAGGLYQCEARRVINNYNLIHHLNLRPQKIQ… |
| A0A1L8GLX8 | 3-102 | QPQRNIRPASEPVLHHSKQSSSIDQETWIDRFKKLENALQLCQIENSGMVEKEKAKCLIHNYNLIYNLSISPVKITEALQKFSSGQN… |
| A0A6P7YB66 | 364-502 | None |
| G5BSM4 | 460-583 | None |
| A0A6I9XHE2 | 1-135 | None |
| A0A1I8JJW4 | 59-156 | None |
| A0A7M7PJP0 | 618-713 | None |
| A0A671NG61 | 241-337 | None |
| A0A6J0TDA0 | 337-444 | None |
| A0A2C9LVY3 | 1-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.