DPCstruct | MC51646
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 137 ± 18 aa |
| Standard deviation of domain lengths | 17.73 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 36.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9LP24 | 1-135 | MGVEVVVGMLIAWVAAKARRAAQRADGVVDDAIDKGVEKVGELVLGKLGGDSAVEQLQLEAAGGEDRVDELTKQRVDLSLQAACKSD… |
| A0A419YQY4 | 1-110 | MVPGVEIAVGYVFAWAVRKARLVAGRADAEVDRAVEAGMDRVHRVVSGKLGGDQALAQVEEEAGAEPAELAAETRQWLELSLNRAAT… |
| A0A2T0MUJ2 | 1-149 | None |
| A0A5N8VDA0 | 27-155 | None |
| A0A6B2DE26 | 2-142 | None |
| A0A0U3QFS6 | 1-106 | None |
| F4FH14 | 5-161 | None |
| A0A4R3C3P9 | 2-140 | None |
| A0A850DFU8 | 2-128 | None |
| A0A7X6D356 | 3-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.