DPCstruct | MC51644
Metacluster Properties and Pfam Annotations
| Number of structural domains | 218 |
|---|---|
| Mean domain length (aa) | 200 ± 42 aa |
| Standard deviation of domain lengths | 41.81 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.24 |
| Pfam Score | 98.61 |
| Assigned Pfam label(s) | PF13677- PF01618 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A420EH08 | 426-614 | ELLIQKFQHAGLIGQTILALFCLGVLVGIYRAIYLGVASYQINRQLKQPSKPSNNPLGRVLNAYQRDKTLNVEALELRILEIIIVEQ… |
| A0A7C1XUF8 | 2-144 | GLEDIFEAGFKEFARLRKQPSADPSAIVEGAQRAMRVALSREEDRVEQGLSFLATVGSTSPYIGLFGTVWGIMNAFRSLGNVHQATL… |
| A0A380W9E3 | 15-221 | None |
| A0A2E9IXB0 | 23-248 | None |
| A0A379US93 | 5-245 | None |
| A0A318B2E9 | 21-227 | None |
| A0A812NFH3 | 14-220 | None |
| A0A0H5DQ43 | 3-177 | None |
| A0A520QEH7 | 2-177 | None |
| A0A511N283 | 6-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.