DPCstruct | MC5164
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 181 ± 26 aa |
| Standard deviation of domain lengths | 25.78 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0536 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7RRT3 | 47-197 | EKFAVYNSYIDKYAVIGKNCYIEDSNILESVVVGEDSIISGITLRNVSVPEKIVLHGLKLKDERYVCRMYRVGDNPKECRWMNKELD… |
| A0A1L8GFA7 | 23-195 | SIFTDQDKNFNETACVIQSVLDAQTAVSPQSVIEYSKLGPDVSVGEYCIISSSCINIRSHIAAKSFVSSLSLMIVEQVMYATILFQW… |
| A0A820SA54 | 23-202 | None |
| A0A287PZQ4 | 196-397 | None |
| A0A674GPR5 | 433-619 | None |
| A0A2H2ILG8 | 189-322 | None |
| A0A2P6NU58 | 466-683 | None |
| A0A7M5WYN1 | 416-611 | None |
| A0A6A7FVF7 | 412-615 | None |
| A0A0D9VNM4 | 601-790 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.