DPCstruct | MC51639
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 86 ± 9 aa |
| Standard deviation of domain lengths | 9.29 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.13 |
| Pfam Score | 86.67 |
| Assigned Pfam label(s) | PF20466- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D6SXY7 | 4-99 | LFKPLFSEGWRIRFAHKTFAWNAQSTDNANVHVVIIGMDTQSDKILQPVLYSYEKINGEPTKTIVSHINPYLVGGGMTFLLKNVVKK… |
| A0A2S7XUJ8 | 56-149 | LWQPLLDAGVCINFAHRTFSWSNEAKNNAAVHVVIIGFALFSVPPKTLFIYADIKGKPQALSATNISPYLFDAPNVIVNARKKPLCL… |
| A0A0X8CMX2 | 157-227 | None |
| K0YDR0 | 197-295 | None |
| W8S9I6 | 101-179 | None |
| A0A418RRS9 | 334-424 | None |
| A0A806GVE0 | 8-86 | None |
| A0A0K8QIM3 | 288-363 | None |
| A0A095YET8 | 173-266 | None |
| A0A6L7WTF4 | 2-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.