DPCstruct | MC51635
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 130 ± 22 aa |
| Standard deviation of domain lengths | 21.52 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 19.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L7GM44 | 4-129 | LLLAACQSVPENARPITIAREAFAGEALYRGSLELVDGCIVAAGHRRAFTALFDPRVVRTASGEGIFEPPTGNTIRFGHPMQGGGGN… |
| A0A7C6LRR3 | 16-118 | WNGDGMGALVTGRLAFTDDGCTLIYQPGQETLATPVIFPDAEGVRFANGVRAVTRQGSGEVFAVEGQEFSYGGGGVPPGEAWSRLCG… |
| A0A4R7J5S8 | 5-93 | None |
| A0A7W8HZW6 | 7-114 | None |
| A0A2S5V118 | 194-309 | None |
| A0A2E0RUQ2 | 14-113 | None |
| N9R3E3 | 3-110 | None |
| A0A7V9DK58 | 4-101 | None |
| A0A7C6TE07 | 3-120 | None |
| A0A8B5XEH7 | 29-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.