DPCstruct | MC51633
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 589 ± 68 aa |
| Standard deviation of domain lengths | 67.78 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.65 |
| Pfam Score | 35.00 |
| Assigned Pfam label(s) | CL0336- CL0091- PF11711- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401L7A1 | 5-609 | ALQGWHPGEVAIQRQLGYATAVSSHWTAVENQLREQHQLFHTSNLPFIPLTTTDTDGRPWAGIVAGSTGTIGFVESPSLKSLVFRAK… |
| A0A0P0NZ40 | 2-492 | PDQHRTFFEQLPIVVLGSRDVSGQPWATLLDGTPGFIKSPSPVELTIAATFSHGDPAAEGVATGQPVGLLGIELHTRRRNRMNGRIS… |
| A0A3N2PQ95 | 2-646 | None |
| A0A0F8WN68 | 194-720 | None |
| A0A093YVK5 | 222-817 | None |
| A0A836DAB1 | 2-722 | None |
| N1QJ18 | 10-644 | None |
| A0A0D2PYB4 | 1-468 | None |
| A0A0D2JXY7 | 6-595 | None |
| A0A1Q9EXE1 | 156-739 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.