DPCstruct | MC51631
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 211 ± 23 aa |
| Standard deviation of domain lengths | 22.55 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 68.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 32.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0KQP2 | 1-207 | MSTITDSLNPKRIGSESRAETHLLDKRRGSSHGGGRGGTKGSGSKSSHGSPGVGPQPTFADGRYYAGGSVRPFKAGAASPRGIRPYA… |
| A0A0B0DQL4 | 70-292 | SSGGGSSGGSGGGRGGSSGGGSTGGSSSGSGRGGSGSSGNSGSGSTGPKTSPTYNGGGRTQYGSGPKPAYGGGRYYGGGAVQPYQSG… |
| A0A0J6FJ92 | 251-472 | None |
| A0A0J9X938 | 39-267 | None |
| A0A0E9NH02 | 65-278 | None |
| A0A6A6UD20 | 20-228 | None |
| A0A167CB62 | 125-320 | None |
| A0A401KP26 | 740-937 | None |
| A0A642V138 | 3-196 | None |
| A0A2U3EEP1 | 327-571 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.