DPCstruct | MC5163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 141 ± 23 aa |
| Standard deviation of domain lengths | 22.66 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 14.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D6BGS3 | 4-130 | QTAVELVVILAVSLLILFVILSLSAQYLGELSSSKSMAEARNGVDDLAAAAKQVYYQGEGAKQQVFVKIPEGTDAQKSGITNRTISL… |
| A0A832X8V2 | 26-182 | PIASQLSQNTKAASVILEQVFIALFGIILLVLVVVAFTSVRDKAIDHISGDQYATVANTVHSGLLLASRNMKISETGVVFLDIPDRI… |
| M0LUU0 | 11-168 | None |
| A0A849Q9X6 | 6-131 | None |
| A0A7C4HIJ1 | 1-166 | None |
| A0A2G9MIH8 | 1-147 | None |
| A0A7T9DJ16 | 2-131 | None |
| A0A497JAN5 | 1-121 | None |
| A0A7X9E1B5 | 1-184 | None |
| A0A7T5RAD5 | 8-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.