DPCstruct | MC51628
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 108 ± 18 aa |
| Standard deviation of domain lengths | 18.48 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B2A143 | 5-102 | DDWADLSWVVQSVRTSGMTDTAELRRHALELIDDVLRGGLMVAGDINADGFHPWGTGSDESASRIEREWTAGWGDAIPPPGAVVWLS… |
| A0A1G5D4G2 | 2-68 | ELLRYALSSGLIEVGELMETGFVAWTGDADEQVRRVTADLDRLDWAPQLGSSVWLSNTAKGDELARR |
| A0A2H0P6I0 | 3-66 | None |
| A0A1W9ZP05 | 67-190 | None |
| A0A1H9NRI6 | 6-91 | None |
| A0A2W5Y4U4 | 4-119 | None |
| A0A1S2PPM4 | 2-83 | None |
| A0A4R0Y7F0 | 47-150 | None |
| A0A2M9BB38 | 3-117 | None |
| A0A1V3WEH8 | 84-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.