DPCstruct | MC51627
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 205 ± 32 aa |
| Standard deviation of domain lengths | 31.63 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.20 |
| Pfam Score | 75.45 |
| Assigned Pfam label(s) | PF07853- PF19124 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1ZYQ3 | 7-209 | DGLPAMIPTHWGITGPDVYSAKTPWTVAMPIAISGLVLAGLFAVSFVNRTMPVRPLPAAEPEVGAARTARLRAALSSFFGRVMFAVT… |
| A0A6C1TZJ9 | 12-221 | LGWLVALYAVIALSVVLLVAGWDRIPDPMPIHWGPRGEADSFDEKTPGAAFSLVAIGAIPLGVLTPLIVYGTHGLARSGSDRDKASA… |
| A0A1Y4NGS3 | 140-350 | None |
| A0A7G7CNR3 | 16-254 | None |
| A9WNH3 | 13-234 | None |
| A0A6Y7C549 | 8-231 | None |
| A0A534Q7V7 | 93-295 | None |
| A0A1V2PM19 | 142-321 | None |
| A0A1E9HP84 | 51-272 | None |
| A0A829ZC65 | 10-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.