DPCstruct | MC51623
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 234 ± 58 aa |
| Standard deviation of domain lengths | 57.97 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 67.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.78 |
| Mean length-normalized TM-Score | 0.18 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08147 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q9UWD9 | 31-251 | THGIEDEILRADGENGYGVDEDELQEAFEDADKKKSFRDPQFFLSHYAPASVIQDQQLSLSTSFANEAQAATFDLDNDDKIQTNKQV… |
| A0A0L0C848 | 3-195 | DLYKEKPKRQKTHKKNTNVKDTENFIPYQSADKHTEDGLAINSFERQAMKAEFSVIDRETNEVRHKPGLQKWDRIKKKMVSVQDPRA… |
| D8LXP4 | 7-217 | None |
| A0A2J7PF11 | 37-241 | None |
| A0A6V7Q042 | 91-320 | None |
| A0A669D9N0 | 210-564 | None |
| A0A5N3ZZ45 | 134-356 | None |
| A0A287PX52 | 1-222 | None |
| A0A498LRP4 | 36-280 | None |
| A0A7S2VZV3 | 1-374 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.