DPCstruct | MC5162
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 65 ± 4 aa |
| Standard deviation of domain lengths | 4.40 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I8CF03 | 1-64 | MLSPHEFATLMLVKAAGEQIDLNREELDTLLERQLVALEQPASGAQRPRLTRDGVSVLRAVARK |
| A0A2G1S503 | 1-64 | MLTAHEFAALFLAHHAPEQIQIDRDDVVALVERRLIVMEHDDASGAHRPALTADGLSVLRGVQR |
| B1KAF4 | 68-132 | None |
| A0A1H4HPN2 | 1-63 | None |
| A0A158J9T2 | 1-62 | None |
| E5AVF9 | 47-109 | None |
| L2E9U5 | 1-75 | None |
| A0A1K0IYB4 | 25-88 | None |
| A0A1H0VT52 | 59-132 | None |
| A0A1D9H5H9 | 1-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.