DPCstruct | MC51619
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 121 ± 13 aa |
| Standard deviation of domain lengths | 13.16 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D4N9D7 | 1-93 | MQLDVYGYVVETLYLAHQSGVARCGDTAVLHQRLVEHLAERWQMPDEGIWEVRGERRHFVHSKVMAWAVVDRTIRLVEAGALDAGLC… |
| A0A484YNQ3 | 2-128 | LGVAKLFVEAGHILDTGTSRFLGHLANQCADRWRMKDSGIWELPDEQHYTHSKMSCWLALDCAVVLAEASHIEPTWKARWKRERDRI… |
| A0A7W1HZ77 | 56-162 | None |
| F4PLG1 | 404-527 | None |
| A0A0K2RCF5 | 18-148 | None |
| A0A178XBV5 | 96-217 | None |
| A0A2A2K6Z5 | 726-878 | None |
| A0A4R3BU35 | 107-236 | None |
| A0A1Y2N9K5 | 599-725 | None |
| A0A2P6NRF1 | 772-897 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.