DPCstruct | MC51614
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 396 ± 71 aa |
| Standard deviation of domain lengths | 70.77 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 71.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 20.77 |
| Pfam Score | 94.12 |
| Assigned Pfam label(s) | CL0220- PF03094 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D8QYZ7 | 39-372 | GKYLRRRKEKSLYQALDKIKEELMLLGFISLLLTVFQPVIASICMPHNFIEHMLPEGLHKLHIFIFVLAVVHVVYSCLTLILGRYKV… |
| A0A7S1ABF7 | 14-439 | IVFIVIAIAFEMFWHRLSHRSDHTYKYGDLQRVGSDDEHLKDNHGHLSHRKLWEELSSRVAGEFMSLGFLAFCIFVFNQLQGFELMA… |
| B9FU41 | 13-388 | None |
| A0A7S3PH98 | 11-542 | None |
| A0A453SGW7 | 9-306 | None |
| A0A7I4CYA2 | 31-371 | None |
| A0A834TPV9 | 20-482 | None |
| A0A1V9Z856 | 193-630 | None |
| A0A0S4JNX7 | 7-444 | None |
| A0A7S3ZW78 | 2-520 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.