DPCstruct | MC5161
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 75 ± 7 aa |
| Standard deviation of domain lengths | 7.49 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662EGS9 | 1-66 | MDEERRLALRASYKRAIERALERVPVRNGVARLHDLWLETAIPKDLIIELLKENEIRFPPHVKRVE |
| A0A3B8N6W4 | 5-89 | RVESLGNNQENFKKALDSAITKAPIRSGNRIYLTDLWIITSIPEEIIVELLTTNNFRLPEEAVAIVDDRRKHKRVLCETSHQGGD |
| D2C736 | 2-70 | None |
| A0A7C5SYW9 | 5-68 | None |
| A0A7G1G5D0 | 11-89 | None |
| A0A1F5UNT0 | 1-79 | None |
| A0A5D0RRR1 | 14-89 | None |
| A0A3B9QPJ6 | 18-85 | None |
| A0A7X7TH38 | 127-202 | None |
| A0A7V2NGT5 | 4-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.