DPCstruct | MC51609
Metacluster Properties and Pfam Annotations
| Number of structural domains | 225 |
|---|---|
| Mean domain length (aa) | 118 ± 18 aa |
| Standard deviation of domain lengths | 18.35 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 24.06 |
| Pfam Score | 79.70 |
| Assigned Pfam label(s) | CL0193- PF05662- PF05658 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V7YDA8 | 15-145 | EGKERSVRHVAKGTADTDAVNVRQLNDVLTQSNEYTDLAVEGLNKRLDGMDKRFNRMAAMSSAQSAMAMNTAGLNTYNRLGAGVGHS… |
| A0A7T2WVM2 | 13-122 | TLTNVSAGVAPTDAVNVQQLNDSLGSVRNQIEHDHRDANGGTASAVAIASLPQAPSPGTSVVAIGGGSHAGQSAMAVGLSTYAGRWI… |
| A0A1Q7B3Q6 | 292-435 | None |
| S7J1B1 | 730-852 | None |
| A0A829W1S3 | 181-304 | None |
| A0A1Y6FEP4 | 592-732 | None |
| A0A1C5TD27 | 333-441 | None |
| A0A809RSD5 | 17-136 | None |
| A0A1V2VTP6 | 3-69 | None |
| A0A7T1GXA3 | 134-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.