DPCstruct | MC51601
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 231 ± 34 aa |
| Standard deviation of domain lengths | 33.84 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H6BTW4 | 53-280 | LACYVLLPLPGAGSGFEPQWRPFAGLGDPALLEQFACNIALFVPLGALLRRGPVAAALVGGTASVIVELTQLTGTWFLFPTPYRVFD… |
| A0A660M1G5 | 1-210 | MPDNSASFCAKQSLSPQLIPFHWVVDAMRPGKHITAALQVIANICFFMPLGAFVALYFRKHIRFAIAAGLGLSFLIEIAQLTGFFHI… |
| S0NHY3 | 5-165 | None |
| A0A7X7V9Z3 | 55-310 | None |
| A0A3E4QSF1 | 67-306 | None |
| A0A2W4H7D1 | 79-330 | None |
| A0A1W6DKL1 | 116-385 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.