DPCstruct | MC516
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 73 ± 3 aa |
| Standard deviation of domain lengths | 3.35 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 38.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C3B3Q0 | 13-88 | GRERRYTVLNEKDLERYVNEEKREEFRQILNEALGEIEDGRLCDDKKAYNSYIVINTDESYINEIIEVMKRHGHFK |
| A0A100VMC9 | 3-71 | IKHTVIKNEDVEKHLNELERVQMLRLLNKVRVGRASEGKQAVNTYLIVNTDEVYATDVVQILKDNGHWG |
| A0A2B4BLH2 | 122-190 | None |
| A0A0F9FY03 | 4-75 | None |
| A0A806LPI4 | 38-114 | None |
| A0A0C2E3A8 | 1-72 | None |
| A0A0Q4QSM0 | 3-81 | None |
| G4KQ93 | 8-80 | None |
| A0A5D4RFN5 | 7-76 | None |
| A0A3G9J1S4 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.