DPCstruct | MC51581
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1403 |
|---|---|
| Mean domain length (aa) | 116 ± 17 aa |
| Standard deviation of domain lengths | 16.57 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 16.02 |
| Pfam Score | 70.04 |
| Assigned Pfam label(s) | CL0023- PF08368- PF07929- CL0236- CL0194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8IKS6 | 19-118 | QETRGENLVRKALESHGIEFHQEYLIAGIPVDFYLPAVQIVIEVDGESHLTTQRQKRDQLVTESLTRLGYQVIRLTGNDVHSPEIIR… |
| A0A6M3IZL5 | 7-107 | FKNYTFPSGKIVKIQGYEDRTIDYLLKIRYKEKDLLVGNDVPKIHYNFKGKDRRYFPDLLIKSENMIVETKSLFTFRKHLPMNLVKR… |
| A0A2W1UBD6 | 2-94 | None |
| A0A6I7WEA0 | 9-87 | None |
| A0A1G1NJS7 | 2-112 | None |
| A0A6P8HFC1 | 833-957 | None |
| A0A263DT18 | 1-134 | None |
| A0A7K1UH45 | 94-211 | None |
| A0A5D8YNT9 | 639-754 | None |
| A0A0E0GPB9 | 918-1041 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.