DPCstruct | MC5158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 112 ± 15 aa |
| Standard deviation of domain lengths | 14.88 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0129 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067M0M8 | 101-207 | LEDAEMMRLQILGDPSLMAQLRETQPELADAAANHPERFAQLLRQQQARQQATESARKQEIEALNADPFDVEAQRRIEEAIRQQAVM… |
| A0A7J7Q4N3 | 15-117 | AFIQAVRTKADMMAAIQHSNPGLAAAIRNEDVPAMQDELKRVRALQREQQAAAAREAELLSADPFDPETQRKIEELIEKQNIEENLA… |
| A0A177WXL9 | 83-222 | None |
| A0A0D0AGM5 | 2-101 | None |
| A0A7M4FGU9 | 460-561 | None |
| A0A178EWD0 | 270-375 | None |
| A0A7J5Z602 | 92-228 | None |
| A0A6A6BG83 | 44-177 | None |
| A0A287TUA5 | 32-153 | None |
| A0A261Y4J2 | 84-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.