DPCstruct | MC51579
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 49 ± 2 aa |
| Standard deviation of domain lengths | 2.40 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.98 |
| Mean intra-cluster local Distance Difference Test score | 0.97 |
| Mean intra-cluster sequence similarity (%) | 67.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08941 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P4WL14 | 106-154 | MNRRHYESYICKRVPGKQAVVVMACDNRHMNDDMLLDPGLVMIFAHGIE |
| A0A821VVD0 | 1-42 | SYICRRIVGKQAVVVLGCDNRHMDQLMIAEPGIVMIFAHGVE |
| A0A1I8F4E9 | 411-458 | None |
| A0A5N5TF43 | 283-331 | None |
| A0A7J8G184 | 196-246 | None |
| A0A0E9S5N7 | 1-52 | None |
| A0A7J7K0R1 | 243-290 | None |
| A0A7M7KIJ9 | 213-260 | None |
| A0A195FFT0 | 99-146 | None |
| A0A816GZX7 | 175-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.