DPCstruct | MC51578
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 53 ± 3 aa |
| Standard deviation of domain lengths | 2.69 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 76.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A653CEF0 | 39-89 | ELVESEDHVEVNGVTFNKPFVEKPVSAEDHNIYIYYPTSAGGGSQRLFRKI |
| A0A821T420 | 1-58 | NEQDDQIEIDGEVFHKPFVEKPVSAENHDVYIYFPSSAGGGSQRLFRKVFKNFAHYTR |
| A0A815RNR0 | 109-161 | None |
| S9WLZ8 | 170-223 | None |
| A0A813VJG3 | 15-66 | None |
| A0A820H757 | 52-104 | None |
| A0A061A6U5 | 66-121 | None |
| A0A4W5RR63 | 112-165 | None |
| A0A6P4F6W2 | 309-354 | None |
| A0A3M6TVQ1 | 211-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.