DPCstruct | MC51577
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 64 ± 4 aa |
| Standard deviation of domain lengths | 4.47 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 60.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0339 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821SW33 | 1-59 | ELRSDISQYGVRNSLLVAPMPTASTAQILGNNESIEPYTSNLYVRRVLSGEFQVNRLYK |
| G5C832 | 442-509 | WNVTPTDLWDWKLLKEKIAKYGIRNSLLIAPIPTASTAQILGNNESIEPYTSNIYTRRILSGEFQIAN |
| A0A6A4HC63 | 427-493 | None |
| A0A0M3J851 | 199-266 | None |
| A0A2R5GSI9 | 105-159 | None |
| A0A7S4UQU0 | 257-324 | None |
| A0A2K3MHW2 | 30-92 | None |
| A0A1Y1S3Z2 | 53-115 | None |
| M5CEI9 | 173-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.