DPCstruct | MC51574
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 58 ± 2 aa |
| Standard deviation of domain lengths | 1.67 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 86.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 71.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821S8X3 | 1-51 | MTHDVRPPFTYATLIRQAIIESPDNQLTLNEVYKWFEGQFLYFRKNAQTWK |
| A0A183G4E0 | 127-185 | ARNREFYRSNDVRPPYTYASLIRQAIMESPECQLTLNEIYTWFTETFAYFRRNAATWKN |
| A0A673YJJ0 | 266-323 | None |
| A0A6F9DDQ9 | 632-689 | None |
| A0A1Y1NLT0 | 508-565 | None |
| A0A1Y1NJI7 | 100-157 | None |
| A0A556U3Q8 | 347-404 | None |
| A0A5B7CS94 | 27-84 | None |
| A0A3Q0DUC2 | 62-118 | None |
| A0A3P8G5J1 | 191-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.