DPCstruct | MC51568
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 164 ± 20 aa |
| Standard deviation of domain lengths | 20.41 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A399WWU5 | 1-164 | MNWNSVIQVAIFLATVILLAKPLGTYMARVYEGKSAGLNVVLGPLERWIYRLSGIETETGMSWKGYAIAMMLFNGIGIVVVYTLQRL… |
| A0A377GL00 | 1-174 | MTKPGFLQIALYLFFLLLLVKPLGWYMAQVYQGRPCFLDIILRPCERLIYKICGIHAQEEMGWKTYLSAMLFLNLAGLLIAYLLQRL… |
| A0A534WFU0 | 1-178 | None |
| A0A1I5TKM9 | 1-172 | None |
| A0A117LS67 | 6-187 | None |
| A0A7I7SM77 | 2-161 | None |
| A0A1V4TRG9 | 228-398 | None |
| I3E0A8 | 2-126 | None |
| A0A0L0LYY9 | 5-143 | None |
| A0A7W8FLV2 | 2-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.