DPCstruct | MC51566
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 104 ± 9 aa |
| Standard deviation of domain lengths | 9.44 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0685 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F9MCK5 | 139-244 | ARLTSMLIPAAAFLLRLDVKGALFILLRDRGRHASPNSGHTEAAVAGAIGIQLGGPNLYFGQLLEKPSIGDPIRPIEPQDILRVNRL… |
| A0A1X1TXD6 | 24-138 | VVGNPTNPTGIVHPAATLCLTAALGPDPRAALRTWRRDARHHPSPNAGVVEAAFAGALGLRFGGVNNDYGDRCEHRAPMGYGRAPAP… |
| A0A374X1E7 | 220-326 | None |
| A0A7C1ME14 | 28-126 | None |
| A0A381QPJ6 | 3-111 | None |
| A0A7X4DVU3 | 50-148 | None |
| R5UX29 | 66-173 | None |
| A0A378AI74 | 24-115 | None |
| A0A7V1NPE4 | 84-191 | None |
| A0A7S4UYU9 | 503-601 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.