DPCstruct | MC51563
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 105 ± 10 aa |
| Standard deviation of domain lengths | 10.15 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J5C6B3 | 2-93 | SVIKKLRQHWMLVLGLLVALGLFSVSVGIAGAYVLAHTSTEEFCVSCHEMSYNFAEYKGTIHDTNRTGVRAICTDCHVPHEPGPLVL… |
| A0A2S9RS43 | 1-116 | MKNKIKAFFLKPSNRIGFGLLVTLGFIAGAISWQQLNNVIDATSTEKFCISCHTMQQPLEEFKQFVHWKNNSGVRATCSDRHVPHEK… |
| P95587 | 2-94 | None |
| A0A7Y2HV11 | 12-105 | None |
| A0A3A1VPA7 | 1-113 | None |
| A0A5J4E0Q4 | 1-109 | None |
| A0A450XGQ0 | 18-139 | None |
| G5R7N3 | 1-104 | None |
| A0A484ZQT3 | 3-98 | None |
| A0A182D0X3 | 1-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.