DPCstruct | MC51561
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 83 ± 11 aa |
| Standard deviation of domain lengths | 10.96 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W1KMM3 | 17-99 | KVTVEHLTEFVATRQGVAAYFEAATSRDPSSIVLVASDGEWTRRKIPSIADAAEVARDLGIELYEVARTGYPREMREWSAKNR |
| A0A849BJI3 | 3-77 | EFARTRVGVEAYLEPATNDTGLTLLLIATDGEWTRRRVPDARTARQFAQDLAMPFYDVNFTGYPQRMRDYNARQR |
| A0A542P8B8 | 16-110 | None |
| A0A7K3H9J2 | 56-151 | None |
| A0A545AIV0 | 3-80 | None |
| A0A6J4WIS0 | 20-85 | None |
| A0A7W0P305 | 2-70 | None |
| A0A286DIE9 | 15-123 | None |
| A0A4Q8CRH5 | 10-100 | None |
| A0A101U424 | 6-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.