DPCstruct | MC5156
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 189 ± 29 aa |
| Standard deviation of domain lengths | 29.32 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 22.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V2Q8F5 | 157-316 | ALGTDSFGTEDGVSAEQAQLVAGALAEAVVVVIDELFDDVNALDEDDTTADQHDELLVIDELPTAFADQYSAWFAKRFLIATVIVGE… |
| A0A7J7Q182 | 52-221 | AEDGSDEDEDFWLSPRMAYRLHTAGCLYVDSRCRPHAELAIAEMPPVVQPCARRRPWMEAYTQAAMRLVARLERGLEPQPNCTAEEC… |
| A0A0M5KU76 | 147-342 | None |
| W7IZ20 | 93-293 | None |
| A0A1I5E408 | 72-248 | None |
| A0A840N6L2 | 152-358 | None |
| S2ZHG9 | 2-168 | None |
| A0A3A5MLI7 | 117-295 | None |
| A0A4Q6IMC7 | 225-440 | None |
| A0A0N9HSX9 | 2-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.