DPCstruct | MC51558
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 91 ± 11 aa |
| Standard deviation of domain lengths | 10.60 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0031 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484MK30 | 1-104 | MKFLSCNVASKYLTSEEKKDEAYFTNLLKVVESTPGLYFSYETDVTLNLQRRYKLAKGWTRKPVWKQADPRFVWNWNLLEELIENKL… |
| A0A3B3XEG8 | 2-79 | INNVLNTDGFYFCTDFDLTHTLQRLANTSPDFQEMSLLERADQRFVWNGNLLRELAGQPELHRFALPVIHGFIVMKPC |
| A0A0N1IDX9 | 2-77 | None |
| A0A2W1BMX3 | 18-120 | None |
| A0A498N9X9 | 598-690 | None |
| A0A7J8VV71 | 45-143 | None |
| A0A3Q3E5H0 | 10-89 | None |
| A0A2T9XXE9 | 105-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.