DPCstruct | MC51555
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 154 ± 21 aa |
| Standard deviation of domain lengths | 20.96 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 69.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 48.62 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | PF01486- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287XHI0 | 1-136 | EEDRELKARLEECVERAQSPDPRLRVEAIDTLRKEIRAATSSMTSVPKPLKFLRAHYGTLKAYFPRMRNPVQKKHMADILSVLALTT… |
| A0A484M5G6 | 1-157 | MPSSRNSAVGSGDAGGKTAREESSIRVPAMDAMKDDDLSEEDLALKQQLELYVKRAQDPDPSLQAVALQGMSQEIQTAISSMTSVPK… |
| A0A4Q2DGJ1 | 43-170 | None |
| A0A821TM34 | 1-114 | None |
| A0A654I648 | 16-181 | None |
| A0A6F9CK22 | 2-155 | None |
| A0A2G8LQ50 | 17-162 | None |
| A0A835RKZ1 | 18-184 | None |
| A0A0C9YKG5 | 38-211 | None |
| F4Q5A0 | 36-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.